PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10859g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 381aa    MW: 42622.7 Da    PI: 6.825
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10859g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.9e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l++++ ++G+g +W + ++++g++R++k+c++rw++yl
    MA_10859g0010 14 KGPWSPEEDCKLKEYIDKHGTGgNWLALPQKVGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding383.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  ++   G++ W+ Ia+ ++ gRt++++k++w++
    MA_10859g0010  69 GGFSEEEDNIICSLFISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.231962IPR017930Myb domain
SuperFamilySSF466892.72E-2611109IPR009057Homeodomain-like
SMARTSM007178.9E-141364IPR001005SANT/Myb domain
PfamPF002493.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-231569IPR009057Homeodomain-like
CDDcd001671.88E-101662No hitNo description
PROSITE profilePS5129421.60763117IPR017930Myb domain
SMARTSM007174.6E-1167115IPR001005SANT/Myb domain
PfamPF002499.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-2370117IPR009057Homeodomain-like
CDDcd001674.07E-871111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDCKLKEYID KHGTGGNWLA LPQKVGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLFISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
LKDRQTCHLV AAKQENKDVQ SYATSEAITS PNIYGPQRYQ HMNMDMDALY SNFGAGIIPH  180
MFEQNCGLTI TEPSSSSEPA TFWLNPQQVQ LDQEVFDHNS GLRKLCQRTE GVLVDHRSNN  240
CMTTISTGSP IQASNCTNPS EIPHSIAHNR YTSDAASLQI YYETAASPVL MYERNMDNHI  300
RQGNPIAASA QNDNSLVFSA SSSPEGENYE SAWMNIFSAE NNNLGAYGFS TELNDLLLYN  360
TDSLLQQREA YNSACGSISI K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5ABB61e-167D5ABB6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.15e-76myb domain protein 36